top of page

CircRNA

Gene

chr8|99511103|99521010|+|2|circRNA|VPS13B|ENST00000496144.5|30,31

VPS13B

CircRNA UID

circVPS13B(30,31)

Open Reading Frame (ORF)

LALLPWLPRLTIPLADLSLGKIFTNNYKTSRWHSSAAWIPLSDIHKSCNKKCPPQVNIKK

Peptide

IFTNNYKTSR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page