top of page

CircRNA

Gene

chr8|99013759|99038566|+|2|circRNA|VPS13B|NM_181661|2,3

VPS13B

CircRNA UID

circVPS13B(2,3)

Open Reading Frame (ORF)

LKLPFTFLSGHIHELRIHVPWTKLGSEPVVITINTMECILKLKDGIQLPTSTPYLKRCWSHM

Peptide

LPTSTPYLK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page