top of page

CircRNA

Gene

chr8|98133948|98140888|+|6|circRNA|POP1|NM_001145860|6,7,8,9,10,11

POP1

CircRNA UID

circPOP1(6,7,8,9,10,11)

Open Reading Frame (ORF)

LGLTVGDPRINLPQKKSKALPNPEKCQGFILLLLFGVERQRGRNTKGAFWNV

Peptide

ALPNPEKCQGFILLLLFGVER

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

11

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page