top of page

CircRNA

Gene

chr8|9761515|9766425|+|5|circRNA|TNKS|ENST00000310430.10|21,22,23,24,25

TNKS

Open Reading Frame (ORF)

LGPGFILLKTPQKATNMFMELEEEQAALHTRTGHAIYVTDYTRCVG

Peptide

ATNMFMELEEEQAALHTR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page