top of page

CircRNA

Gene

chr8|94842346|94856978|+|6|circRNA|INTS8|NM_017864|10,11,12,13,14,15

INTS8

Open Reading Frame (ORF)

LELVTEFSPKLRQVMLNEMLLLDIHTHEAGTGQAGERPPSDLISRVRGYLEMRLPEMKL

Peptide

GYLEMRLPEMK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page