top of page

CircRNA

Gene

chr8|94734629|94761834|+|6|circRNA|DPY19L4|NM_181787|3,4,5,6,7,8

DPY19L4

Open Reading Frame (ORF)

LLMSASTYTFMMMWEYSHYLLFLQAISLFLLDTFSVEQSDKMYYFNALQRFSLAVLQRLLVV

Peptide

MYYFNALQR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page