top of page

CircRNA

Gene

chr8|94671452|94692827|+|4|circRNA|ESRP1|ENST00000423620.6|11,12,13,14

ESRP1

CircRNA UID

circESRP1(11,12,13,14)

Open Reading Frame (ORF)

LATSLQLLILAVSLHSLARWSECRAWPTILELRKFLTSSKVTRC

Peptide

AWPTILELR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page