top of page

CircRNA

Gene

chr8|8327709|8328461|-|1|circRNA|SGK223|ENST00000622241.1|4

SGK223

CircRNA UID

circSGK223(4)

Open Reading Frame (ORF)

LASGSRAGGQQRRLREPWPPVQRGPLRLILPAERVQSSLHREHPASAARSPEQHQQQGGHLCQAGGTLHPVPGPPCSQM

Peptide

LASGSRAGGQQR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page