top of page

CircRNA

Gene

chr8|70127089|70128432|-|1|ciRNA|NCOA2|ENST00000452400.6|18

NCOA2

Open Reading Frame (ORF)

LGSLPFIHPAFPPSPPSTSDSVSVRSYQALSSLSPFPPASAQPFVKCTTSPFVPVILFLYRLECHLNETLNYHPQGLYYSLLIERTVLF

Peptide

SYQALSSLSPFPPASAQPFVK

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page