top of page

CircRNA

Gene

chr8|70123883|70162854|-|13|circRNA|NCOA2|ENST00000452400.6|21,20,19,18,17,16,15,14,13,12,11,10,9

NCOA2

CircRNA UID

circNCOA2(21,20,19,18,17,16,15,14,13,12,11,10,9)

Open Reading Frame (ORF)

MFSQQSPPHFGQQANTSMYSNNMNINVSMATNTGGMSSMNQMTGQISMTSVTSVPTSGLSSMGPEQARSRLWIPAP

Peptide

SRLWIPAP

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page