top of page

CircRNA

Gene

chr8|690897|692612|—|2|circRNA|ERICH1|ENST00000524138.5|3,2

ERICH1

Open Reading Frame (ORF)

MPRASPKHSLAAAEPMEPPGPSGARGQEKQGWDPSLSDPPRSVWEHGTQEGRAFELFWLQF

Peptide

ASPKHSLAAAEPMEPPGPSGAR

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

22

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page