top of page

CircRNA

Gene

chr8|67257731|67288065|-|11|circRNA|ARFGEF1|ENST00000262215.7|17,16,15,14,13,12,11,10,9,8,7

ARFGEF1

CircRNA UID

circARFGEF1(17,16,15,14,13,12,11,10,9,8,7)

Open Reading Frame (ORF)

LAYSIIMLTTDLHSPQHYLKMKCYMTEKTMIVRKSHKTLYRTL

Peptide

LAYSIIMLTTDLHSPQHYLK

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TAG

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page