top of page

CircRNA

Gene

chr8|67251298|67302466|-|18|circRNA|ARFGEF1|ENST00000262215.7|19,18,17,16,15,14,13,12,11,10,9,8,7,6,5,4,3,2

ARFGEF1

Open Reading Frame (ORF)

LYNLEMEQMAKTAKALMEAVSHVQAPFTSATHLEHVRPMFKRK

Peptide

ALMEAVSHVQAPFTSATHLEHVRPMFKR

ORF Found in Long-Read

false

Peptide Length

28

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

27

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page