top of page

CircRNA

Gene

chr8|61555923|61646878|—|14|circRNA|ASPH|NM_001164750|19,18,17,16,15,14,13,12,11,10,9,8,7,6

ASPH

Open Reading Frame (ORF)

LSVTPNDGFAKVHYGFILKAQNKIAESIPYLKLREKTCNKKMDPQENHNKRMMSFLWRLM

Peptide

RMMSFLWR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page