top of page

CircRNA

Gene

chr8|55953831|55966897|+|2|circRNA|LYN|ENST00000519728.5|8,9

LYN

Open Reading Frame (ORF)

LWSPGRSPFTSSPSTWPRSRQMACAEDWRRLVLVPSHRSHGIKMPGRSPGSPSSW

Peptide

LWSPGRSPFTSSPSTWPR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page