top of page

CircRNA

Gene

chr8|52628031|52636069|—|4|circRNA|RB1CC1|ENST00000025008.9|22,21,20,19

RB1CC1

Open Reading Frame (ORF)

LVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGEKIFICCLKKNSG

Peptide

IFICCLKK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page