top of page

CircRNA

Gene

chr8|47817449|47831926|-|9|circRNA|PRKDC|ENST00000314191.6|68,67,66,65,64,63,62,61,60

PRKDC

Open Reading Frame (ORF)

LNTWTNRYPDAKMDPMNIWDDIITNRCGRPDGPTTTAQTVYEGPGEAQFDVCQKRRC

Peptide

CGRPDGPTTTAQTVYEGPGEAQFDVCQK

ORF Found in Long-Read

false

Peptide Length

28

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

28

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page