top of page

CircRNA

Gene

chr8|47782161|47794501|-|7|circRNA|PRKDC|ENST00000314191.6|80,79,78,77,76,75,74

PRKDC

CircRNA UID

circPRKDC(80,79,78,77,76,75,74)

Open Reading Frame (ORF)

LKDLLLNTMSQEEKAAYLRSLPFPAGSSSAGSATWWPYWTKTKPLLFSTLWKKSLITTRRLLFIPSS

Peptide

TKPLLFSTLWKK

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page