top of page

CircRNA

Gene

chr8|47440322|47599196|+|3|circRNA|SPIDR|ENST00000297423.8|8,9,10

SPIDR

CircRNA UID

circSPIDR(8,9,10)

Open Reading Frame (ORF)

LDPWAQRSKTAHPNQHSPEGFSPGCGGKPGSCLVARSWSPSGGAKSVFSSQQRQHQGSAGGQLRTHRPSWNSVENLVY

Peptide

THRPSWNSVENLVY

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page