top of page

CircRNA

Gene

chr8|42906172|42959314|+|7|circRNA|HOOK3|NM_032410|2,3,4,5,6,7,8

HOOK3

Open Reading Frame (ORF)

MKLCQQRKKLLKDAMNWICRSRHLMWMHHARPWKI

Peptide

DAMNWICRSR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page