top of page

CircRNA

Gene

chr8|42439449|42444762|-|2|circRNA|SLC20A2|NM_001257180|7,6

SLC20A2

CircRNA UID

circSLC20A2(7,6)

Open Reading Frame (ORF)

LTKASVRFRKQSPQYLKSYQVPRLMMTAPSRSREQQGRHWGPRKALLRAATLGLHTCSALFSPCGP

Peptide

LTKASVR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page