top of page

CircRNA

Gene

chr8|39136656|39257343|+|15|circRNA|ADAM32|NM_001313994|2,3,4,5,6,7,8,9,10,11,12,13,14,15,16

ADAM32

Open Reading Frame (ORF)

MERASGKTENTWLLGFLIALPILIVTTAIVLARKQLKKWFAKEEEFPSSENKYPILFQ

Peptide

EEEFPSSENK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page