top of page

CircRNA

Gene

chr8|38836161|38838546|+|2|circRNA|TACC1|ENST00000519416.5|7,8

TACC1

CircRNA UID

circTACC1(7,8)

Open Reading Frame (ORF)

LEMRGCWSPLQRRPLCRCPVEVRAPWMGSASANQTRQPCSP

Peptide

GCWSPLQR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page