top of page

CircRNA

Gene

chr8|38314646|38348215|—|11|circRNA|WHSC1L1|ENST00000317025.12|12,11,10,9,8,7,6,5,4,3,2

WHSC1L1

Open Reading Frame (ORF)

MKYRQVSTRNQSMKAEKKRGKKATSMTHQDLKSASHTKSPN

Peptide

ATSMTHQDLK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page