top of page

CircRNA

Gene

chr8|37870419|37875322|-|2|circRNA|RAB11FIP1|ENST00000287263.8|4,3

RAB11FIP1

Open Reading Frame (ORF)

LPHWSVGTSGKTWPPQTQRPQKKLRRARSQRAGGPLCCL

Peptide

SQRAGGPLCCL

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page