top of page

CircRNA

Gene

chr8|28356669|28361182|—|3|circRNA|ZNF395|NM_018660|4,3,2

ZNF395

Open Reading Frame (ORF)

MDEMMAAMVLTSLSCSPVVQSPPGTEANFSGDGQRLQCPLRLRRRGEAAAWRVSCPDALESGPSWEPGCWDPVPRRGPRLPHPRSHC

Peptide

GDGQRLQCPLR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page