top of page

CircRNA

Gene

chr8|28129501|28162078|+|7|circRNA|ELP3|NM_001284222|8,9,10,11,12,13,14

ELP3

Open Reading Frame (ORF)

MLLMEEAERIAREEHGSGKIAVISGILREASQSVLELLLKPDQITA

Peptide

IAVISGILR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page