top of page

CircRNA

Gene

chr8|25372558|25380394|+|5|circRNA|DOCK5|NM_024940|35,36,37,38,39

DOCK5

CircRNA UID

circDOCK5(35,36,37,38,39)

Open Reading Frame (ORF)

MWEKAIKLSKELAETYESKVFDYEGLGNLLAPRTLPETQIPLQLWGGLRPPGQQPLREPAGL

Peptide

ELAETYESKVFDYEGLGNLLAPR

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116,PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page