top of page

CircRNA

Gene

chr8|23027132|23029721|-|4|circRNA|TNFRSF10B|ENST00000276431.8|7,6,5,4

TNFRSF10B

Open Reading Frame (ORF)

LQPTQVPEQEMEVQEPAEPTGVNMLSPGESEHLLVKWS

Peptide

LQPTQVPEQEMEVQEPAEPTGVNMLSPGESEHLLVK

ORF Found in Long-Read

false

Peptide Length

36

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

35

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page