top of page

CircRNA

Gene

chr8|22636677|22636921|-|1|ciRNA|BIN3|ENST00000276416.10|3

BIN3

CircRNA UID

ciBIN3(3)

Open Reading Frame (ORF)

LEAEGSSGHQAAGTVPWQWPCESHSLIAFGCSGTSVSGKSPRGEDPFLVSVNPRKMRWEAGRDKGPLPGLTCLPRALPREHPGS

Peptide

GEDPFLVSVNPR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page