top of page

CircRNA

Gene

chr8|22412206|22414778|+|1|ciRNA|SLC39A14|NM_001128431|4

SLC39A14

CircRNA UID

ciSLC39A14(4)

Open Reading Frame (ORF)

LTCTRAHIPESRTQLLGFLKLNPMILYSPSFVAFCREVFVAYFHFTFPPR

Peptide

AHIPESR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page