top of page

CircRNA

Gene

chr8|17980590|17986087|+|3|circRNA|PCM1|ENST00000325083.12|24,25,26

PCM1

Open Reading Frame (ORF)

MKVPVCLAHVNLAKVGTDIQPRLKSLFKQKYSAERIMSNWKK

Peptide

VPVCLAHVNLAKVGTDIQPR

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page