top of page

CircRNA

Gene

chr8|15730665|15748465|+|3|circRNA|TUSC3|NM_006765|7,8,9

TUSC3

CircRNA UID

circTUSC3(7,8,9)

Open Reading Frame (ORF)

LGLVVFFFSFLLSIFRSKYHGYPYRATFMGAARLSLWQNHTLFWY

Peptide

YHGYPYRATFMGAAR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page