top of page

CircRNA

Gene

chr8|144555559|144581277|-|2|circRNA|ARHGAP39|NM_025251|3,2

ARHGAP39

Open Reading Frame (ORF)

LRRTMRFTGITVRTASFFTTGWSGWRSSNRAPASACTPTWSPVSACGTRRPASASSAPARTSGGSCSTPTRPASTTTMPARSARCGTGRRAATSSRWPSCRR

Peptide

RPASASSAPAR

ORF Found in Long-Read

true

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page