top of page

CircRNA

Gene

chr8|143536256|143539320|—|2|circRNA|ZC3H3|NM_015117|3,2

ZC3H3

Open Reading Frame (ORF)

LPTMLCGRCTGPGGASLLSRSSMSLRDRSSSVRVRTWSSKLNRHQSLALPVPQGPSGALWKNLRKPPGVTKGPGKVKVSPLGDSCSPRGQQEPGGPAVWKILFWSARRSLVSPGW

Peptide

HQSLALPVPQGPSGALWK

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

true

bottom of page