top of page

CircRNA

Gene

chr8|143379508|143379809|+|1|ciRNA|RHPN1|ENST00000620174.1|8

RHPN1

Open Reading Frame (ORF)

MQGVGPSWGQSPGPGMRELSHLLPCVSAPSQLLSCSLGGLVRNLGTRASASRGWHKAAGTEVPGRLLGWWSEQVEAG

Peptide

MQGVGPSWGQSPGPGMR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page