top of page

CircRNA

Gene

chr8|143290744|143293065|+|2|circRNA|ZNF696|ENST00000523891.1|2,3

ZNF696

Open Reading Frame (ORF)

LFQLLVFCKMEPGGEPTGAKESSTLMESLAAFQLEMRDLRSAAGGRARDLDRRCILPGEG

Peptide

SAAGGRAR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page