top of page

CircRNA

Gene

chr8|142300485|142354763|—|9|circRNA|TSNARE1|ENST00000524325.5|10,9,8,7,6,5,4,3,2

TSNARE1

Open Reading Frame (ORF)

LPSWLMMRRSLTGVTTCGRARSRRCSRTSLKRTWRPSGCGRRPSCRWSSVWRLLALPSVRRCHTDPSPVEVAWGAVALSGDLRDKAVSP

Peptide

LLALPSVR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page