top of page

CircRNA

Gene

chr8|140789473|140921132|—|13|circRNA|PTK2|ENST00000519419.5|14,13,12,11,10,9,8,7,6,5,4,3,2

PTK2

Open Reading Frame (ORF)

LRGILQAAGKYYRRNTFQILLQALKKGAHRGTLVLLVDRSKYYHSEELGLCVQTPGLIFIGLGVCCWNWQAKRP

Peptide

GILQAAGK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page