top of page

CircRNA

Gene

chr8|140700890|140879637|-|23|circRNA|PTK2|ENST00000522684.5|26,25,24,23,22,21,20,19,18,17,16,15,14,13,12,11,10,9,8,7,6,5,4

PTK2

Open Reading Frame (ORF)

LAGKRGKISGHHSEDSGQSQSKACGLLWIPPQSPAVRGGSLASRGYGRLQCEGEV

Peptide

ACGLLWIPPQSPAVRGGSLASR

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

22

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page