top of page

CircRNA

Gene

chr8|140664916|140668424|-|2|circRNA|PTK2|ENST00000522684.5|31,30

PTK2

CircRNA UID

circPTK2(31,30)

Open Reading Frame (ORF)

LWMRPFPSYQPAPTESFSPRKSAPLLLPTWTGRMIRCTRM

Peptide

KSAPLLLPTWTGR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page