top of page

CircRNA

Gene

chr8|140397619|140405698|-|2|circRNA|TRAPPC9|NM_001160372|7,6

TRAPPC9

Open Reading Frame (ORF)

LSWKRASRLYVSLQFRNGAWKHQNFFRMQFTLTFDRCPHHQWHQP

Peptide

HQNFFRMQFTLTFDR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page