top of page

CircRNA

Gene

chr8|140221458|140405698|—|12|circRNA|TRAPPC9|NM_001160372|17,16,15,14,13,12,11,10,9,8,7,6

TRAPPC9

Open Reading Frame (ORF)

LSSPFRQVVRPRVEGKPVNPPESNKAGDYSHVKVPSPPMASTLTPVLRSDVLRTALALKT

Peptide

SDVLRTALALK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page