top of page

CircRNA

Gene

chr8|134600435|134602933|-|2|circRNA|ZFAT|ENST00000520356.5|7,6

ZFAT

Open Reading Frame (ORF)

MTATSVSASSRTSWTVTAICWSTETSGLLPVSSVAMGPPSTRRWNCMSGSTPSCTSVPSAARSSSAPSGCAPTSKRCTGLPRRPWSSPVPSTRASASWNLVGTSSKKLWGTSYSWWKRSLPSRA

Peptide

RWNCMSGSTPSCTSVPSAAR

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page