top of page

CircRNA

Gene

chr8|131940498|131979019|+|12|circRNA|EFR3A|ENST00000254624.9|2,3,4,5,6,7,8,9,10,11,12,13

EFR3A

Open Reading Frame (ORF)

LPGSFLDPLLSPSLMEDYELRQLVLEVMHNLMDRHDNRAKLRGIRSMLLLFRFASSLQTPGGQHIP

Peptide

GIRSMLLLFR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page