top of page

CircRNA

Gene

chr8|130152735|130180880|—|6|circRNA|ASAP1|NM_001247996|14,13,12,11,10,9

ASAP1

Open Reading Frame (ORF)

MAEEEVFSQEWDSDHLTCHIQKLRKRKESTQNNMG

Peptide

MAEEEVFSQEWDSDHLTCHIQK

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page