top of page

CircRNA

Gene

chr8|123371669|123380677|—|3|circRNA|ATAD2|ENST00000287394.9|4,3,2

ATAD2

Open Reading Frame (ORF)

LRARNIVQSTEHLHEDNGDVEVRRSCRIRSRYSGVNQSMLFDKLITKMGHQLRKLKPTTGHVL

Peptide

LITKMGHQLR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page