top of page

CircRNA

Gene

chr8|123322937|123339446|-|7|circRNA|ATAD2|ENST00000517666.5|25,24,23,22,21,20,19

ATAD2

CircRNA UID

circATAD2(25,24,23,22,21,20,19)

Open Reading Frame (ORF)

MIKHHLFRCKNCLSVIMERFLMSSYRIKKNGQNFLKI

Peptide

NCLSVIMER

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page