top of page

CircRNA

Gene

chr8|123084161|123097441|+|3|circRNA|TBC1D31|ENST00000287380.5|4,5,6

TBC1D31

Open Reading Frame (ORF)

LAAGGKSNHLHLWCLEARQLFRIIQMPTKVRAIRHLEFLPDSFDAGSNQSPRS

Peptide

AIRHLEFLPDSFDAGSNQSPR

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TAG

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page