top of page

CircRNA

Gene

chr8|116655855|116726172|—|4|circRNA|EIF3H|ENST00000521861.5|5,4,3,2

EIF3H

Open Reading Frame (ORF)

LKKANITFEYMFEEVPIVIKNSHLINVLMWELEKKSAVADKHELLSLASRWY

Peptide

HELLSLASR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page